PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa18g035270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family LFY
Protein Properties Length: 223aa    MW: 24650.3 Da    PI: 4.4781
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa18g035270.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY199.72e-6112221222
         FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslse 95 
                     mdpe f++slf+w+p  a++++p+ + +  +++ +p + ++aa  ++l +le lf ayG+r++t+akiaelGft+stLv+mkdeel+++m+sls+
  Csa18g035270.1   1 MDPEGFTSSLFRWNPTRAMVPAPSPVPPPLQQQ-PP-TPQTAAFGMRLGGLEGLFGAYGIRFYTAAKIAELGFTASTLVGMKDEELEEMMNSLSH 93 
                     9*************9999989888887666544.44.466777788889********************************************** PP

         FLO_LFY  96 ifrldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqe....glseepvqeekeaagsggeglgeaelvaaeek 179
                     ifr++llvGeryGikaavraerrrl+e  ee++++rr+ll      + +++aldalsqe    glseepvq++ ++ ++g++g g +e+ + +  
  Csa18g035270.1  94 IFRWELLVGERYGIKAAVRAERRRLQEeeEEESSRRRHLLlsaagDSGTHHALDALSQEddwtGLSEEPVQQQDQTDAAGNNG-GYWEAGQGK-- 185
                     *************************99544456778887778844344556*******988889******9977766666555.677765544.. PP

         FLO_LFY 180 kseeekkkaskkkqkrkkkkelkseededeeeeededeegsge 222
                           kk +  +++rkk   ++ e+d+d +e ed+d++++g+
  Csa18g035270.1 186 -----MKKLQP-QRRRKKPMVASVETDDDGNEGEDDDGMDNGN 222
                     .....233323.4444444454566777777777777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.3E-711223IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MDPEGFTSSL FRWNPTRAMV PAPSPVPPPL QQQPPTPQTA AFGMRLGGLE GLFGAYGIRF  60
YTAAKIAELG FTASTLVGMK DEELEEMMNS LSHIFRWELL VGERYGIKAA VRAERRRLQE  120
EEEEESSRRR HLLLSAAGDS GTHHALDALS QEDDWTGLSE EPVQQQDQTD AAGNNGGYWE  180
AGQGKMKKLQ PQRRRKKPMV ASVETDDDGN EGEDDDGMDN GNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ude_A6e-25461518110GINLFY PROTEIN
4ude_B6e-25461518110GINLFY PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4471030.0DQ447103.1 Arabidopsis thaliana clone pENTR221-At5g61850 floral meristem identity control protein LEAFY (At5g61850) mRNA, complete cds.
GenBankDQ4719320.0DQ471932.1 Brassica juncea cultivar Varuna LEAFY transcription factor mRNA, complete cds.
GenBankDQ6533890.0DQ653389.1 Arabidopsis thaliana clone 0000013258_0000009567 unknown mRNA.
GenBankKF0510220.0KF051022.1 Arabidopsis thaliana protein leafy (LFY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010457875.11e-161PREDICTED: protein LEAFY isoform X1
SwissprotQ009586e-95LFY_ARATH; Protein LEAFY
TrEMBLQ3ZLS61e-108Q3ZLS6_SELAU; LEAFY protein (Fragment)
STRINGAT5G61850.11e-92(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.14e-73floral meristem identity control protein LEAFY (LFY)